Anti-RHBDF1 PAb
- creativediagnostics
Owned by creativediagnostics
Sept 26, 2019
1 min read
Loading data...
Antibody Name (copy page name from title above) | Anti-RHBDF1 PAb |
|---|---|
| Other names, clone ids, catalog ids etc. | Anti-RHBDF1 (aa 287-336) polyclonal antibody ;DPABH-18149 |
| Does it work on zebrafish? (Yes or No) | yes |
| Host organism | Rabbit |
| Immunogen organism | Synthetic peptide corresponding to a region within N terminal amino acids 287-336 (ALKDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQP K) of Human RHBDF1 (NP_071895). |
| Antibody isotype | IgG |
| Antibody type (monocional, polycional, or none) | Polyclonal |
| Anatomical structures recognized (use terms from the ZFIN Anatomical Ontology) | |
| Recognized target molecules (gene names, domains, epitopes ...) | RHBDF1 |
Recognized ZFIN genes | |
| Supplier(s) | Creative Diagnostics |
Assays Tested
Assay (ChIP, IHC, IP or WB) | Prep | Worked (Yes or No) | Notes |
|---|---|---|---|
| WB |
Submitter Note
(Add note here)