Anti-RHBDF1 PAb

Antibody Name (copy page name from title above)	Anti-RHBDF1 PAb
Other names, clone ids, catalog ids etc.	Anti-RHBDF1 (aa 287-336) polyclonal antibody ;DPABH-18149
Does it work on zebrafish? (Yes or No)	yes
Host organism	Rabbit
Immunogen organism	Synthetic peptide corresponding to a region within N terminal amino acids 287-336 (ALKDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQP K) of Human RHBDF1 (NP_071895).
Antibody isotype	IgG
Antibody type (monocional, polycional, or none)	Polyclonal
Anatomical structures recognized (use terms from the ZFIN Anatomical Ontology )
Recognized target molecules (gene names, domains, epitopes ...)	RHBDF1
Recognized ZFIN genes current ZFIN-gene symbols only ZFIN Gene Search
Supplier(s)	Creative Diagnostics

Assay _{(ChIP, IHC, IP or WB)}	Prep	Worked _{(Yes or No)}	Notes
WB

(Add note here)

Antibodies