Anti-RHBDF1 PAb

Antibody Name (copy page name from title above)	Anti-RHBDF1 PAb
Other names, clone ids, catalog ids etc.	Anti-RHBDF1 (aa 287-336) polyclonal antibody ;DPABH-18149
Does it work on zebrafish? (Yes or No)	yes
Host organism	Rabbit
Immunogen organism	Synthetic peptide corresponding to a region within N terminal amino acids 287-336 (ALKDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQP K) of Human RHBDF1 (NP_071895).
Antibody isotype	IgG
Antibody type (monocional, polycional, or none)	Polyclonal
Anatomical structures recognized (use terms from the ZFIN Anatomical Ontology)
Recognized target molecules (gene names, domains, epitopes ...)	RHBDF1
Recognized ZFIN genes current ZFIN-gene symbols only ZFIN Gene Search
Supplier(s)	Creative Diagnostics

Assay _{(ChIP, IHC, IP or WB)}	Prep	Worked _{(Yes or No)}	Notes

Assay _{(ChIP, IHC, IP or WB)}	Prep	Worked _{(Yes or No)}	Notes
WB

(Add note here)