/
Anti-RHBDF1 PAb
Anti-RHBDF1 PAb
Antibody Name (copy page name from title above) | Anti-RHBDF1 PAb |
---|---|
Other names, clone ids, catalog ids etc. | Anti-RHBDF1 (aa 287-336) polyclonal antibody ;DPABH-18149 |
Does it work on zebrafish? (Yes or No) | yes |
Host organism | Rabbit |
Immunogen organism | Synthetic peptide corresponding to a region within N terminal amino acids 287-336 (ALKDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQP K) of Human RHBDF1 (NP_071895). |
Antibody isotype | IgG |
Antibody type (monocional, polycional, or none) | Polyclonal |
Anatomical structures recognized (use terms from the ZFIN Anatomical Ontology) | |
Recognized target molecules (gene names, domains, epitopes ...) | RHBDF1 |
Recognized ZFIN genes | |
Supplier(s) | Creative Diagnostics |
Assays Tested
Assay (ChIP, IHC, IP or WB) | Prep | Worked (Yes or No) | Notes |
---|---|---|---|
WB |
Submitter Note
(Add note here)